YaleGerstein Lab Parts ListGeneCensusMolecular MovementsNESG helpdownload

Data for Methanococcus janaschii ORF MJ0721

Structural Annotation for this ORF
Genecensus Resources for Methanococcus janaschii

Genome image courtesy of NCBI

General Organismal Information
ORF idMJ0721
Organism Categoryarchaea
Number of ORFs in Genome1735
Physiological Conditions of Organism85 C, anaerobe

Genomic Information
Amino Acid SequenceMSQENWIDLEKKYHLQIYGRLPVVLVEGKGMEVYDIDGKKYLDFLAGIGVNNVGHCHPKV VEAIKKQAETLIHTSNIYYTIPQIKLAKKLVELSGLDRAFFCNSGAEANEGAIKFARKYV SKVLGREGGEIISMYNAFHGRTLTTLAATPKPKYQDGFYPLPPGFKYVPFNDIEALKEAI TDKTAAIMIEPVQGEGGIHVADKDYLKAVRDLCDDKNIVLIFDEVQCGMGRTGRMFAFEH YGVEPDILTLAKALGGGVPIGAVVLKEEIAKALSYGDHGTTFGGNPLACSAALASVEVIE ELIKDDKVIEKGKYFIRKLENLIEKYNFIKEVRGLGLMIGAELEFNGADIVKKMLEKGFL INCTSDTVLRFLPPLIVEKEHIDALINALDEVFTEIKK
Amino Acids in Genome (most->least)I; K, L; E; V; A, D, G; N, S; F, R, T, Y; P; M, Q; C, H, W
Amino Acids in Helices (most->least) (plot)L, K, E; I; A; V; R; D, F, Y; G, M, N, S, T; Q; H, P, W; C

Other resources
NCBI annotation for MJ0721
NCBI Complete genome annotation located here.
TIGR annotation for MJ0721